PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07539.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CPP
Protein Properties Length: 463aa    MW: 50323 Da    PI: 7.1632
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07539.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.82.9e-15152189340
                             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                      k+C+Ckks+Clk+YC C+a+g++C+e+C Ce C Nk 
  Zmw_sc07539.1.g00010.1.sm.mkhc 152 IKSCSCKKSRCLKLYCVCYASGSHCTESCGCEPCLNKP 189
                                     589*********************************85 PP

2TCR44.82.4e-14230265439
                             TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                     ++C+Ckks ClkkYC+C++ ++ Cs +CkCedCkN 
  Zmw_sc07539.1.g00010.1.sm.mkhc 230 RKCTCKKSGCLKKYCDCYQGMAGCSINCKCEDCKNP 265
                                     79*********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.6E-9150191IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.191151267IPR005172CRC domain
PfamPF036382.7E-11153188IPR005172CRC domain
SMARTSM011141.6E-12229268IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.7E-10230264IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
ASCTVRSIPS SPLGNPSPRR PAHPFRPYAR PTPPPSPAAL ARLRFVVTAN PAPPVPPIVA  60
PPVPDPMDAE EGPTAPEAEA AGSDPDDAER TASPPPPPAP TPAPPPVPPV STEAAADPES  120
VGPPPDVSPL PAEANGSFDR RKKRKTEDGD GIKSCSCKKS RCLKLYCVCY ASGSHCTESC  180
GCEPCLNKPI QGAQRSAPAP VLPLKFAKTS ETGQDLLEQP LRSPMDIFRR KCTCKKSGCL  240
KKYCDCYQGM AGCSINCKCE DCKNPFGRKV GIILDGKSSF VVPPTLNEGN GTEVDSSDDE  300
DDYYMNRAPS SIPPSPVSRE SSFQQDTLVG VEIQTLNGHL YPKPLTQVRP DSSSWQFTKR  360
PGEYARGEQW NFSRRPSEDG TSDAMEGHND PKFQRTNKKL ENHMDQFSIP RCIEVMNSMA  420
ELSPIEKSLA PDVFLDPSNR EIFLTLAVDV RTLWLRRKMK SLV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963115.11e-177PREDICTED: protein tesmin/TSO1-like CXC 7
TrEMBLK3Z6R91e-177K3Z6R9_SETIT; Uncharacterized protein
STRINGSi022238m1e-177(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP96102834